skin-1004-peptide Human Neutrophil Peptide-1 (HNP-1), also known as a-Defensin-1 or Human Neutrophil Peptide, is a significant peptide molecule with a range of biological activities.作者:EJ Yavin·1995·被引用次数:7—...peptideswhich modulateneutrophilfunction: Implication to the anti-inflammatory mechanism. Eran J. Yavin,; Oren Rosen,; Michel Pontet,; Enid G. Shephard ... If you are looking to buy HNP-1, understanding its properties, applications, and where to source it is crucial for researchers and scientists. This article delves into the nature of neutrophil peptides, specifically focusing on neutrophil peptide 1, and provides information relevant to purchasing it for scientific endeavorsProteolysis of human C-reactive protein by neutrophil-derived ....
Neutrophils, a type of white blood cell, are a critical component of the innate immune system作者:F Yu·2022·被引用次数:9—Neutrophil peptide-1promotes the repair of sciatic nerve injury through the expression of proteins related to nerve regeneration · Full Article .... Within their azurophilic granules, they store a variety of antimicrobial and cytotoxic proteins, including the human neutrophil peptides (HNPs). Among these, HNP-1 stands out as one of the principal human defensins作者:R Gandotra·2022·被引用次数:17—However, up to 40% of culture-negative PJI needs other surrogate biomarkers such as humanneutrophil peptide 1(HNP 1) to improve diagnostic .... These peptides are characterized by their broad-spectrum antimicrobial activity, effective against both Gram-positive and Gram-negative bacteria. Furthermore, HNP-1 exhibits cytotoxic properties, meaning it can induce lysis of mammalian cells under certain conditions.
The structure of HNP-1 is a cyclic peptide, stabilized by disulfide bridges, with a specific amino acid sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC. This sequence is essential for its functional interactions, including its ability to bind to bacterial cell wall precursors like lipid II.Neutrophil peptide-1 promotes the repair of sciatic nerve ... This binding mechanism is believed to be a key factor in its antimicrobial efficacy, as it disrupts bacterial membrane integrity.
The multifaceted nature of neutrophil peptide 1 has led to its investigation across various scientific fields. Its antimicrobial properties make it a candidate for developing novel antibacterial agents.Defensin HNP-1human is a Humanneutrophil peptides(HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Research also points to its involvement in endothelial cell dysfunction during the early stages of atherosclerotic development, suggesting a role in cardiovascular health.
Beyond its direct antimicrobial and cytotoxic functions, HNP-1 has been explored for its potential in other therapeutic areas. Studies have investigated its role as an immunotherapeutic agent and as a possible adjunct to antituberculosis chemotherapy. Furthermore, neutrophil peptides are being studied for their involvement in autoimmune responses and allergic asthma, highlighting the complex roles these molecules play in human health and disease. There is also emerging research indicating that neutrophil peptide-1 can promote the repair of sciatic nerve injury, underscoring its potential in regenerative medicine.
For researchers studying the intricacies of the immune system or developing new diagnostic tools, HNP-1 is a valuable reagent. It is also utilized in HNP1-3 ELISA kits and HNP1-3(Neutrophil Peptide 1-3) ELISA kits, which are designed for quantitative detection and are valuable for metabolic research studies and other scientific investigationsDefensin HNP-1 (human) (trifluoroacetate salt). These kits provide a reliable method for measuring neutrophil peptide 1-3 levels in biological samples.Editorial: The role of neutrophils and its NETosis in autoimmunity ... - NIH
When you decide to buy neutrophil peptide 1, several factors warrant attention to ensure you acquire a high-quality product suitable for your research needs.
* Purity and Form: HNP-1 is typically available in purified forms, often as a trifluoroacetate salt. The purity level is critical for obtaining accurate and reproducible experimental results.Human neutrophil peptide 1 Manufacturers usually specify the purity percentageHuman HNP1-3(Neutrophil Peptide 1-3) ELISA Kit ... This kit is based on Double antibody-Sandwich ELISA detection method and takes 4h assay time. The microplate ....
* Quantity and Packaging: HNP-1 is sold in various quantities, ranging from milligrams to larger bulk orders, depending on your research scale. Common packaging sizes include 0.Defensin HNP-1is apeptidesecreted by polymorphonuclear leukocytes (PMNs) that has antimicrobial properties. It induces lysis of mammalian cells when used at ...1 mg.Mammalian defensins are abundant in the cytoplasmic azurophilic granules ofneutrophils, Paneth cells of the small intestine and some macrophages. Hu…
* Supplier Reputation: It is advisable to buy from reputable scientific suppliers known for providing high-quality research chemicals.Randox Health | Helping to shape a healthier future Companies like Merck, Bachem, and others specializing in peptides and biochemicals are reliable sourcesHuman neutrophil peptide 1-3,HNP1-3 ELISA Kit.
* Product Specifications and Documentation: Always review the product specifications, including catalog numbers (e.g.Human defensin-1(HNP-1) is apeptidepossessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities., Catalog No.Defensin-1, human; HNP-1 [99287-08-8] 50-260-257 for Bachem's HNP-1), chemical identifiers (like [99287-08-8] for Defensin-1, human; HNP-1), and any associated documentation such as Certificates of Analysis (CoA) or Material Safety Data Sheets (MSDS).
* Storage and Handling: Proper storage and handling are essential to maintain the integrity of HNP-1. Manufacturers will provide specific recommendations, typically involving cold storage (e.g., -20°C or -80°C) and protection from moistureRole of Human Neutrophil Peptide-1 as a Possible Adjunct to ....
When searching to buy HNP-1, you will encounter various offerings, including the peptide itself and related research tools like HNP1 Elisa Kit for Sale Online. Researchers looking for specific neutrophil peptides or general peptides for their work will find a growing market for these specialized compounds. The availability of Human Neutrophil Peptide-1, NP-1 / HNNP-1 GENLISA™ kits also indicates the ongoing research interest in this molecule.
In summary, Human Neutrophil Peptide-1 is a vital component of the innate immune system with significant antimicrobial and other biological activitiesAS-60743 | HNP-1, α-Defensin-1. For those seeking to buy neutrophil peptide-1, understanding its properties and sourcing it from reliable suppliers is paramount for successful scientific research. The diverse applications and ongoing investigations into neutrophil peptides underscore their importance in modern biological and medical science.
Join the newsletter to receive news, updates, new products and freebies in your inbox.